DPCfam | MC78895
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 52 ± 6 aa |
| Residues in low-complexity regions (%) | 0.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.32 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00685 |
| Sequences matching dominant architecture (%) | 92.11 |
| Average overlap percent | 29.85 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F8AC58 | 121-186 | 66 | VIRSVKDGNLNEYIVRYGMYATHIRRFLKFFPKTQMKFIILEEFSKEPSKFFGEIFRFLGVDDSFN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZFR1-F1 | 270-320 | 98.08 | 98.34 | View in AlphaFoldDB ↗ |