DPCfam | MC78700
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 74 ± 1 aa |
| Residues in low-complexity regions (%) | 1.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16213 |
| Sequences matching dominant architecture (%) | 62.5 |
| Average overlap percent | 43.79 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E9IPZ2 | 1-74 | 74 | MEDLLLQIIRESNNARLQNLRKSAQEAHDFLEKQQGLLRDPPHELRAKCLHTFQLALESNRSKFVAFGLAGLHN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3UGY8-F1 | 1-74 | 100.00 | 82.54 | View in AlphaFoldDB ↗ |