DPCfam | MC78689
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Residues in low-complexity regions (%) | 0.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06101 |
| Sequences matching dominant architecture (%) | 12.5 |
| Average overlap percent | 11.33 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E9CV84 | 496-557 | 62 | TLYPSNRTPNAPIEWFSFRGHWGDKIYPLGERRQYRFAGQYHYVSGPLGPRFKNLARRKVCQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PXU0-F1 | 628-699 | 100.00 | 88.12 | View in AlphaFoldDB ↗ |