DPCfam | MC78653
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 328 ± 46 aa |
| Residues in low-complexity regions (%) | 7.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.36 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B8LVX4 | 10-325 | 316 | MGPPSGRLHWDDKDLLQVAVPPFTEPTISPSTNNSSRADITKWRVLQSGNAAELYHPEWAQNTLFLDTASLTAKMPRISDDVLLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WD21-F1 | 8-343 | 99.41 | 73.15 | View in AlphaFoldDB ↗ |