DPCfam | MC78462
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 155 ± 45 aa |
| Residues in low-complexity regions (%) | 5.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W5D5W4 | 383-512 | 130 | IKAKGPIPYKTDIKAIVFEFTGGTGDRFLFPKNSILEYLTGGTQVIASFLIFRKGDTSTYGSYKKTTDYYQPVTIRLSTHNPRTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q758T8-F1 | 508-670 | 100.00 | 85.31 | View in AlphaFoldDB ↗ |