DPCfam | MC78454
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 193 ± 25 aa |
| Residues in low-complexity regions (%) | 2.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.05 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF06082 |
| Sequences matching dominant architecture (%) | 78.24 |
| Average overlap percent | 44.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M9RBV9 | 19-192 | 174 | ADAQDDWRANYTLYGTPGIIDMPSAAAPADAELSATVSVFGDTQRATFTFQVLPRFTGSFRYSLIDTYDRSFDVQYQIASEGEYR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZKI1-F1 | 30-235 | 94.35 | 92.26 | View in AlphaFoldDB ↗ |