DPCfam | MC7808
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 224 ± 36 aa |
| Residues in low-complexity regions (%) | 0.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16993 |
| Sequences matching dominant architecture (%) | 42.5 |
| Average overlap percent | 51.22 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F4LPY1 | 1-236 | 236 | MNFFINSDLSNLSSGIEHAQLKRLRLFQQFGQPAKILTTYYRNNWAEGPGRFGLTTNDVLNIFDYFGHNIHVHHRPNHIAQFCRQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2G0L3-F1 | 1-234 | 98.29 | 95.44 | View in AlphaFoldDB ↗ |