DPCfam | MC77876
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Residues in low-complexity regions (%) | 2.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05667 |
| Sequences matching dominant architecture (%) | 96.4 |
| Average overlap percent | 61.56 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G5E1G9 | 1-101 | 101 | QSIRQFNTELIVEAVVRCLRVINPSVGSSLGHVLPPGMSARFRIGTSLAQACQDLGYPGDVGYQTFLYSSEPDIRALLIFLAEKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4V909-F1 | 1-119 | 96.75 | 83.87 | View in AlphaFoldDB ↗ |