DPCfam | MC77874
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Residues in low-complexity regions (%) | 0.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00024 |
| Sequences matching dominant architecture (%) | 10.0 |
| Average overlap percent | 16.09 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E5S8K6 | 396-465 | 70 | LGVLFSKHEEICYQLVKGTSHDQIVTLDGQTIVLLQRCVKDREEDRKNNIVFFHYYFHELEEKCVFEFYD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z5D5-F1 | 288-360 | 98.70 | 78.71 | View in AlphaFoldDB ↗ |