DPCfam | MC77742
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 519 ± 47 aa |
| Residues in low-complexity regions (%) | 3.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.39 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF00406 |
| Sequences matching dominant architecture (%) | 52.89 |
| Average overlap percent | 27.95 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B3S727 | 438-976 | 539 | HPVDFRLSRQIIETGYKQSSQFGWWCPVKLFDKEVVQPLHGPGVSTYPVVHRSHVYYLSSEDARQRFIDNPLKYIHQSPPGPVIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5TCS8-F1 | 1333-1859 | 99.62 | 83.43 | View in AlphaFoldDB ↗ |