DPCfam | MC77660
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 971 |
|---|---|
| Mean domain length (aa) | 231 ± 37 aa |
| Residues in low-complexity regions (%) | 2.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05742 |
| Sequences matching dominant architecture (%) | 93.56 |
| Average overlap percent | 89.77 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q12AK3 | 1-233 | 233 | MCLIAFAINASERWPLVIAANRDEYLNRPSLPLARWTSVSGREIISGRDLRAGGTWLGMTPDGRVAFLTNVREGYPQAAAPRSRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I6F4-F1 | 1-226 | 99.12 | 96.14 | View in AlphaFoldDB ↗ |