DPCfam | MC77136
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 156 ± 16 aa |
| Residues in low-complexity regions (%) | 4.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02893 |
| Sequences matching dominant architecture (%) | 89.47 |
| Average overlap percent | 14.53 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C9MVM2 | 21-163 | 143 | TFWTNLKENNYFILQQTKTQKSGLMRSVLGTLQNVLDTKQSPYRILFRRVNGTSLQVAVAETEKKAAIAWGWIESNLLPLLDSLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1Q7J9-F1 | 14-179 | 99.39 | 76.90 | View in AlphaFoldDB ↗ |