DPCfam | MC77135
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 151 ± 12 aa |
| Residues in low-complexity regions (%) | 2.08 |
| Residues in coiled-coil regions (%) | 0.22 |
| Predicted disordered residues (%) | 24.86 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A132A801 | 52-193 | 142 | LRVERLDKNSRKHLEQQTARHIAGGQHQGIIVNKYLAQNENVFRGQFDLRLSFKVYLVNAITQIHQQESRELRFWFDNSIVSNGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7FCF2-F1 | 13-154 | 98.68 | 91.60 | View in AlphaFoldDB ↗ |