DPCfam | MC76888
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 273 ± 45 aa |
| Residues in low-complexity regions (%) | 2.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.31 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00076- PF14111 |
| Sequences matching dominant architecture (%) | 36.82 |
| Average overlap percent | 91.67 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K7KJJ8 | 1-213 | 213 | WKDETDITSFYFTRFPEDVNEKDLWNIFREWGQVWEIFISKHRNKGGRRYGFVRFRGVADINRLESMKTLVEAEEEIAWELGSDI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0LF44-F1 | 91-265 | 57.00 | 62.09 | View in AlphaFoldDB ↗ |