DPCfam | MC76739
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 809 ± 104 aa |
| Residues in low-complexity regions (%) | 4.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.97 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G0A8H0 | 20-703 | 684 | LMDIINPLSVYALTSGPASPEFSSFEPVSTTNMVNEFNGAFTYNIPLLEIPGPNGSGYPLSLSYHSGTTTEEESSWVGFGWTLNP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0P0V5T7-F1 | 422-540 | 14.96 | 63.84 | View in AlphaFoldDB ↗ |