DPCfam | MC76658
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 70 ± 11 aa |
| Residues in low-complexity regions (%) | 28.56 |
| Residues in coiled-coil regions (%) | 0.92 |
| Predicted disordered residues (%) | 9.33 |
| Average transmembrane regions | 1.44 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F9K8E5 | 3-63 | 61 | KVLAILGGLIAMAAGVYLVILVWPQQFIDLVFGCIPPVLFFGGFIALIAGISGIKDAARTK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6NE62-F1 | 2-53 | 74.29 | 92.26 | View in AlphaFoldDB ↗ |