DPCfam | MC76231
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Residues in low-complexity regions (%) | 4.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02734 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 42.29 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00083091DA | 78-138 | 61 | LMGARGNSGVILSQLFRGFSKAVQGATRMDVRIFAQALQEGVDIAYKAVSKPVEGTILTVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8CSV4-F1 | 76-146 | 95.95 | 95.58 | View in AlphaFoldDB ↗ |