DPCfam | MC76154
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 361 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Residues in low-complexity regions (%) | 0.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.66 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF09907 |
| Sequences matching dominant architecture (%) | 97.75 |
| Average overlap percent | 77.62 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E4FP08 | 3-95 | 93 | VIAPKALRSFWEQPGYGDAEGPLRSWLQEAKAAKWSRWEDIKARYRAADWVGNNRVVFDIGGNKYRLIVRVNFASQTLFVVFIGT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8FEM8-F1 | 2-93 | 98.89 | 97.01 | View in AlphaFoldDB ↗ |