DPCfam | MC7607
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Residues in low-complexity regions (%) | 0.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.38 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF11865 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 46.67 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G4VCG1 | 923-1019 | 97 | FFSVCALSALIHSLRDPALHSQYGSIVHTIVYVLKLLGPRSVIYLRQLIPDYFRCLENTRDARLQEFLIRQLGNVMTIVQLNTKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B0UX67-F1 | 926-1025 | 94.34 | 83.37 | View in AlphaFoldDB ↗ |