DPCfam | MC75945
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 140 ± 16 aa |
| Residues in low-complexity regions (%) | 1.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.09 |
| Average transmembrane regions | 0.97 |
| Dominant Pfam architecture(s) | PF04193 |
| Sequences matching dominant architecture (%) | 98.44 |
| Average overlap percent | 21.89 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A087T2I6 | 20-150 | 131 | SLTVSDQDLKFGIYENGSFKIFLSESVSESITVWFSYTEGNNLYPLPNDTVIEKGTKPSLTFGVSARTAGHTTILAKVTPPIVLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VCR7-F1 | 29-172 | 99.33 | 93.30 | View in AlphaFoldDB ↗ |