DPCfam | MC75860
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 369 ± 77 aa |
| Residues in low-complexity regions (%) | 13.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 53.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13298 |
| Sequences matching dominant architecture (%) | 84.75 |
| Average overlap percent | 32.9 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F5LF75 | 40-330 | 290 | CMECRVIRINHLIETASHKTGSMIIWDTGEYEVLPYPMEGPSAPETDDSRSEISDEGSVPASISLEQQMSDSAKLHEAFQNGKIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1D0V7-F1 | 68-570 | 100.00 | 72.37 | View in AlphaFoldDB ↗ |