DPCfam | MC75846
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 199 ± 28 aa |
| Residues in low-complexity regions (%) | 4.59 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 27.46 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF06461 |
| Sequences matching dominant architecture (%) | 0.41 |
| Average overlap percent | 60.11 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183WTS7 | 96-245 | 150 | RIYKWTNFRQLANLSRKSDQALVEYFHSFYRMCQRVCKKELTEFAEPASTIATTTTSGSSDLGCEIIIDPISEERASRCLSRIDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZA12-F1 | 1429-1600 | 90.31 | 81.64 | View in AlphaFoldDB ↗ |