DPCfam | MC75803
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 163 ± 16 aa |
| Residues in low-complexity regions (%) | 6.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.67 |
| Average transmembrane regions | 2.39 |
| Dominant Pfam architecture(s) | PF03176 |
| Sequences matching dominant architecture (%) | 58.14 |
| Average overlap percent | 16.74 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R5MM42 | 292-440 | 149 | LCFMSFKLGLDIGLVMAKGVLLGVITVVTFLPALILLLDDKIEKTRHKSLVPHFGKLNEFTLKHRRVIAIIFLLLIIPAYGASKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58957-F1 | 10-91 | 46.86 | 90.44 | View in AlphaFoldDB ↗ |