DPCfam | MC7559
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1131 |
|---|---|
| Mean domain length (aa) | 181 ± 27 aa |
| Residues in low-complexity regions (%) | 2.88 |
| Residues in coiled-coil regions (%) | 2.69 |
| Predicted disordered residues (%) | 25.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00995 |
| Sequences matching dominant architecture (%) | 97.23 |
| Average overlap percent | 37.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Y9WC94 | 706-891 | 186 | IIIDRRIDMVTPFCTPFTYEGLIDHIFCIENLQIEIPRYIIFNNGANKIEAENSKTTTPKGYPSNDLNNKKIRVKLNSSIDVLYN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WJ16-F1 | 230-428 | 98.34 | 88.84 | View in AlphaFoldDB ↗ |