DPCfam | MC75558
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 156 ± 11 aa |
| Residues in low-complexity regions (%) | 4.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.05 |
| Average transmembrane regions | 2.69 |
| Dominant Pfam architecture(s) | PF07670 |
| Sequences matching dominant architecture (%) | 29.38 |
| Average overlap percent | 63.03 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q6RFQ2 | 16-174 | 159 | VPLILASVGIHALISGTDIFPALCRGAVQGLETLKDMLPTLIVLFPAVYMLRASGALDALSALLAPLMERIGIPAETVPLALLRP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P35158-F1 | 12-171 | 100.00 | 91.05 | View in AlphaFoldDB ↗ |