DPCfam | MC7532
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 109 ± 32 aa |
| Residues in low-complexity regions (%) | 8.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.27 |
| Average transmembrane regions | 2.62 |
| Dominant Pfam architecture(s) | PF09858 |
| Sequences matching dominant architecture (%) | 99.26 |
| Average overlap percent | 84.19 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E8MYP2 | 38-145 | 108 | GYAVCHRAPARSFWLEDRPTPVCARCSGTFLGSGLSLVYILRKGKRALFPPRWMMMVFAGFALFFALDGANSFLSALPGLSSLYS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58887-F1 | 42-147 | 100.00 | 97.49 | View in AlphaFoldDB ↗ |