DPCfam | MC75224
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 253 ± 44 aa |
| Residues in low-complexity regions (%) | 5.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00612- PF00612 |
| Sequences matching dominant architecture (%) | 32.61 |
| Average overlap percent | 18.79 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6CWS1 | 18-289 | 272 | EYVAAQTLQRYFRGYITRKHMKFLHKKATIIQSNWRGVLGRKQANRVIKNKLDAMYQKFYDKSAIMIQKAFRGFYVRKYVFSFYK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96L03-F1 | 48-330 | 100.00 | 81.98 | View in AlphaFoldDB ↗ |