DPCfam | MC75089
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Residues in low-complexity regions (%) | 4.41 |
| Residues in coiled-coil regions (%) | 0.43 |
| Predicted disordered residues (%) | 11.8 |
| Average transmembrane regions | 0.15 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D8PZC4 | 852-936 | 85 | RIGANKATKNSNEAEYRNIFDTLISDALAVLYLPEWPAASVLLSTAAKHLLRLFDDSNSSAEATSAPAKAIALDHLGTIATRIRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q00333-F1 | 975-1055 | 96.20 | 81.24 | View in AlphaFoldDB ↗ |