DPCfam | MC75048
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 421 |
|---|---|
| Mean domain length (aa) | 164 ± 17 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.92 |
| Average transmembrane regions | 0.31 |
| Dominant Pfam architecture(s) | PF04442 |
| Sequences matching dominant architecture (%) | 97.56 |
| Average overlap percent | 87.29 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G0JZS8 | 8-174 | 167 | RLALKLAGVAVGMFGFGYALVPLYEVVCEYTGLGGRTGIVTAAEAAALDVNRGREVVVEFDTNINGTLPWSFTSLQRRITVHPGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A3KNN8-F1 | 79-246 | 98.80 | 85.53 | View in AlphaFoldDB ↗ |