DPCfam | MC74916
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Residues in low-complexity regions (%) | 1.29 |
| Residues in coiled-coil regions (%) | 31.44 |
| Predicted disordered residues (%) | 23.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00210 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 43.27 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L0TK86 | 71-138 | 67 | IPEADGIPAAEEMIRQLVEGQEAVICTARAIFPLTDSANDKPTADLLTQRMQIHEKTAWMLRAMLGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45173-F1 | 100-154 | 96.49 | 98.17 | View in AlphaFoldDB ↗ |