DPCfam | MC74912
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 592 ± 112 aa |
| Residues in low-complexity regions (%) | 5.42 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 29.74 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF00439- PF01426- PF01426- PF00505 |
| Sequences matching dominant architecture (%) | 30.0 |
| Average overlap percent | 88.97 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009B45AED | 818-1485 | 668 | NPEKPPLNFEIIRTNVDRGRYKRLDVFQDHMFEVLEKARRLNRTDSEIFEDAVELQQFFIRIRDELCKNGEILMSPALSYTSKHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86U86-F1 | 819-1445 | 99.83 | 80.33 | View in AlphaFoldDB ↗ |