DPCfam | MC7487
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 441 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Residues in low-complexity regions (%) | 4.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.21 |
| Average transmembrane regions | 0.96 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B7AP80 | 39-138 | 100 | YNPCYKGPNQNRSCTDIICCFLFVVFLAGLAAVACIAYIYGDPQTLIYPQDSNGNLCGHGSRSDRKYLFFFDLSVCGRMGPGVFV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q94AN2-F1 | 26-123 | 92.55 | 88.64 | View in AlphaFoldDB ↗ |