DPCfam | MC74668
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 123 ± 22 aa |
| Residues in low-complexity regions (%) | 3.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07859 |
| Sequences matching dominant architecture (%) | 2.0 |
| Average overlap percent | 3.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C4DIQ0 | 21-110 | 90 | DCFRRHFQEYRQSLSSPGIVQNTFIVVPIELIPESQNEELDPYWVWAYDADWDNSTEETVCSRGEKYQGRVKVAIYSLNAWFYAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NXQ6-F1 | 544-660 | 94.21 | 91.17 | View in AlphaFoldDB ↗ |