DPCfam | MC74608
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 127 ± 8 aa |
| Residues in low-complexity regions (%) | 1.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14467 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 90.17 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T0Y6E7 | 28-143 | 116 | KTQGYAIYYSAVATDTIPMQVAARHGLRRAADEGVVNISVMRGPDAARGTPVAATVRGAAYTLLGKRLALNFRAIDDAGMVYYLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I6A7-F1 | 12-136 | 97.74 | 92.80 | View in AlphaFoldDB ↗ |