DPCfam | MC74600
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Residues in low-complexity regions (%) | 3.67 |
| Residues in coiled-coil regions (%) | 10.81 |
| Predicted disordered residues (%) | 29.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B0EXK2 | 563-664 | 102 | GLICVKLGMVTEETDVEELLDVVISVGKSVQENSRVLDSMSEIVKKGIETVTADLQRESDEKLWQDGILRHVPIVGSVFNWWSPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q99K01-F1 | 572-682 | 99.12 | 74.42 | View in AlphaFoldDB ↗ |