DPCfam | MC74472
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Residues in low-complexity regions (%) | 1.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02128 |
| Sequences matching dominant architecture (%) | 27.66 |
| Average overlap percent | 1.54 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L8WRC8 | 143-224 | 82 | VGPKEPTIDQEKGIAFAEEVVGGKWNQSPVKLEYIARDDGSCALTYVVQVVGSDGSWKELYVSAYDGKLLNVVDFVADSSVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C5P7A7-F1 | 169-243 | 80.72 | 90.66 | View in AlphaFoldDB ↗ |