DPCfam | MC74438
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 185 ± 23 aa |
| Residues in low-complexity regions (%) | 4.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.55 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF11522 |
| Sequences matching dominant architecture (%) | 71.91 |
| Average overlap percent | 28.37 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D9PRP2 | 1-197 | 197 | MSWDLLKRFIESDVFNQNPFLSVAYLSRYADHVGIHYVLCSKLRQFSYEEIEFFLPQLCHLIISVNNESVALEEFILDLCEDSVN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PXT9-F1 | 5-191 | 98.54 | 78.13 | View in AlphaFoldDB ↗ |