DPCfam | MC74397
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Residues in low-complexity regions (%) | 29.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.83 |
| Average transmembrane regions | 2.88 |
| Dominant Pfam architecture(s) | PF17647 |
| Sequences matching dominant architecture (%) | 93.75 |
| Average overlap percent | 88.84 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L0JVG5 | 132-245 | 114 | AVLGAVVTVALSFLPFSPAFGGALAGYLERAESDRTVSVGTLAGLLPAIPVLAMLVFVAGGVLSGLLTVGQTGEAVVVGATLLLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58886-F1 | 11-125 | 95.54 | 84.08 | View in AlphaFoldDB ↗ |