DPCfam | MC74267
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 165 ± 14 aa |
| Residues in low-complexity regions (%) | 4.32 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 35.17 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12721 |
| Sequences matching dominant architecture (%) | 8.89 |
| Average overlap percent | 16.55 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00097C0BC2 | 121-279 | 158 | EDGAFLIPIHDSGKSGAPADFDLFSVAEQFFWNQQLQFVVANYKAHLHAMNNQAPTPPSQVTYNVSGSNARVNINSADFSQNIVQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GZ61-F1 | 18-166 | 92.40 | 78.44 | View in AlphaFoldDB ↗ |