DPCfam | MC73716
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 345 ± 34 aa |
| Residues in low-complexity regions (%) | 2.06 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 9.44 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF07470 |
| Sequences matching dominant architecture (%) | 2.97 |
| Average overlap percent | 39.84 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A1ASY6 | 31-387 | 357 | YCKAMGYQGWDNFDGLNSRIVDSAPFHYSYILRLIWIQFFKRFPLNLRKLTLVPKGYNPKGLALFVSGLVYSGQYDEAKSLIDIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P33247-F1 | 459-486 | 7.80 | 98.78 | View in AlphaFoldDB ↗ |