DPCfam | MC73369
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 112 ± 27 aa |
| Residues in low-complexity regions (%) | 0.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10908 |
| Sequences matching dominant architecture (%) | 98.39 |
| Average overlap percent | 85.52 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E64299 | 25-158 | 133 | AYSGQGSYINKAAGTCTPTYGAIPAGTYYIFDRRSGGALGPWKERLNLNRNNKSEWFALYAIDGHIDDDKLLCDGIIRGQFRLHP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54RW3-F1 | 30-63 | 27.13 | 90.92 | View in AlphaFoldDB ↗ |