DPCfam | MC73134
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Residues in low-complexity regions (%) | 2.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16213 |
| Sequences matching dominant architecture (%) | 11.41 |
| Average overlap percent | 43.76 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A094A4C2 | 799-862 | 64 | LRILKLMEGMISGPGGELLSDESVCEMMETGLSMCCQSRLSELLRRSAEMSMIKMCQVIFERLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A286Y9X1-F1 | 134-202 | 100.00 | 90.62 | View in AlphaFoldDB ↗ |