DPCfam | MC73087
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 375 ± 52 aa |
| Residues in low-complexity regions (%) | 3.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.13 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF13692 |
| Sequences matching dominant architecture (%) | 41.07 |
| Average overlap percent | 29.56 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4H2P9 | 390-780 | 391 | PNRRICVVTTASLPWRTGTAVNPLLRAAYLTRGRPSKYVTLLLPWLEEDQQGIVFPKGKRFKTQDEQARYVKEWLSESAGMAEEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6EBE4-F1 | 313-694 | 100.00 | 92.80 | View in AlphaFoldDB ↗ |