DPCfam | MC73003
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 375 ± 38 aa |
| Residues in low-complexity regions (%) | 16.77 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 1.8 |
| Average transmembrane regions | 9.73 |
| Dominant Pfam architecture(s) | PF04892 |
| Sequences matching dominant architecture (%) | 82.35 |
| Average overlap percent | 28.35 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B8GV78 | 13-427 | 415 | ALAWLGVVLYLTLLPFTFGDMSLAEAWARYQNIRFDGSGPRARQQWVSNVLMFVPLGFLWAGWWLHRVRSPWLQGGGAVLVAGFC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1JV19-F1 | 10-153 | 40.36 | 91.20 | View in AlphaFoldDB ↗ |