DPCfam | MC72986
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 347 ± 25 aa |
| Residues in low-complexity regions (%) | 8.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.48 |
| Average transmembrane regions | 9.48 |
| Dominant Pfam architecture(s) | PF04346 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 97.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D6BPT3 | 8-390 | 383 | VLYLIMLCAVLGAFAAIYDSERGLGKEFMEGIHATGYIFVPAAGIMASIPYLTVVIETVFGPFFNSLGADPALAATMIIASDMGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GFN0-F1 | 8-354 | 99.43 | 92.76 | View in AlphaFoldDB ↗ |