DPCfam | MC72948
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Residues in low-complexity regions (%) | 3.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.67 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X0HH34 | 99-207 | 109 | GVTVQNAASDVIEAVYSFTRYWANYVSMDLGPWLINWIPFGYLISNQIQIWYPNFVLPIVDSFVYDFLVPVVNDPLNLSVWAQGI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-L7N693-F1 | 188-289 | 94.64 | 30.71 | View in AlphaFoldDB ↗ |