DPCfam | MC72898
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 484 ± 63 aa |
| Residues in low-complexity regions (%) | 6.2 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 29.28 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13812 |
| Sequences matching dominant architecture (%) | 6.67 |
| Average overlap percent | 7.63 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U7K7A7 | 74-579 | 506 | RRDPQWTWGCYIALLNIIDPDEVPLELHQLVLRKCTHSAREQRENLSRRLRAGNRPRTSHSHEVRFQAIIHNIRQAGHTPALDDY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9LYZ9-F1 | 300-375 | 15.64 | 87.61 | View in AlphaFoldDB ↗ |