DPCfam | MC72787
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 104 ± 10 aa |
| Residues in low-complexity regions (%) | 1.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.75 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00282 |
| Sequences matching dominant architecture (%) | 65.85 |
| Average overlap percent | 11.11 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E0SJQ5 | 39-125 | 87 | GFQTNQQGEFDAVLRPLLDMNLLNLGDSMEPGAYQVNSKRFERAVLDYYARLWNLPSPYWGYLTAMGSTEGNLFALWNARDFLCG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LKX3-F1 | 65-165 | 98.06 | 96.09 | View in AlphaFoldDB ↗ |