DPCfam | MC72461
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 121 ± 19 aa |
| Residues in low-complexity regions (%) | 5.95 |
| Residues in coiled-coil regions (%) | 2.31 |
| Predicted disordered residues (%) | 10.56 |
| Average transmembrane regions | 0.66 |
| Dominant Pfam architecture(s) | PF01944 |
| Sequences matching dominant architecture (%) | 74.01 |
| Average overlap percent | 6.87 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E4BAW5 | 273-410 | 138 | RLVARKQARWDEFGALAGRASRGGLDALSADELPDFAARYREVAADLARARTYGAEPRLRARLERLVAAGHNLLYRDERKTWARV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8F071-F1 | 1-128 | 99.25 | 86.56 | View in AlphaFoldDB ↗ |