DPCfam | MC72346
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Residues in low-complexity regions (%) | 4.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 47.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06244 |
| Sequences matching dominant architecture (%) | 97.01 |
| Average overlap percent | 56.03 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183DDG4 | 7-79 | 73 | TARTVAEAISILSVEKPVIDRHPEKRVKAAYQEFEEKMLPRLKEEYPTYRLSQLKQVLKKQWQKSPDNPLNQK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PH93-F1 | 117-198 | 93.90 | 86.42 | View in AlphaFoldDB ↗ |